Greater TAMPA BAY

The intelligent home.
Finally arrived.

JYVVE designs, installs and integrates your home’s lighting, climate, security, audio and AI—so every system works together and feels effortless to use.

The JYVVE difference

Everything connected. Nothing complicated.

We design, coordinate and integrate your home’s lighting, climate, audio, security and more—then make it all feel natural to use.

01 · One accountable partner

One expert. Every detail.

From your Digital Blueprint through installation and handoff, we coordinate the products, specialists and timing.

02 · Whole-home simplicity

Your whole home, working as one.

Lighting, climate, audio, security, shades and access respond together—with simple scenes, voice and intelligent routines.

03 · Open + evolving

Built around your life. Never locked in.

We choose the right products for your home—not a dealer ecosystem—so the experience can evolve without starting over.

A JYVVE Intelligent Home Integrator guides a Florida couple through their personalized smart-home plan
Lighting scene active Climate balanced Home secured
Plan · coordinate · integrate We make the whole home work.

One accountable Intelligent Home Integrator—from Blueprint to finished experience.

What we integrate

Every system.
One intelligent conversation.

From a natural voice command to the air you breathe, JYVVE integrates every system around the way your home should feel—not around the technology.

01 / 12
Intelligent security integrated by JYVVE 01 / 12
Protect

Intelligent security

AI-enabled cameras and discreet sensors detect people, motion and unusual activity, then alert you whether you’re home or away.

Whole-home audio integrated by JYVVE 02 / 12
Listen

Whole-home audio

We place and connect speakers so music plays in any room, groups instantly and stays simple to control from one place.

Climate intelligence integrated by JYVVE 03 / 12
Comfort

Climate intelligence

Smart thermostats and room sensors adjust temperature by schedule, occupancy and preference—keeping each space comfortable without wasting energy.

Airflow & comfort integrated by JYVVE 04 / 12
Balance

Airflow & comfort

We coordinate fans, vents and room sensors to correct hot, cold or stagnant spaces and keep air moving quietly.

Access & entry integrated by JYVVE 05 / 12
Arrive

Access & entry

Smart locks, gates, garage doors and video entry give family and guests secure access, with remote control and arrival alerts.

Architectural lighting integrated by JYVVE 06 / 12
Illuminate

Architectural lighting

We specify fixtures, dimmers and keypads, then create lighting scenes for arrival, entertaining, evening and sleep.

Responsive heating integrated by JYVVE 07 / 12
Warm

Responsive heating

Thermostats, radiant heat and room sensors deliver warmth where and when you need it—not across the entire home.

Wellness bath integrated by JYVVE 08 / 12
Restore

Wellness bath

Smart showers, tubs, heated floors and water controls save personal settings and prepare the bath before you enter.

Automated floor care integrated by JYVVE 09 / 12
Reset

Automated floor care

Robot vacuums and mops follow room-by-room schedules, avoid restricted areas and report when cleaning or maintenance is needed.

Cinema & streaming integrated by JYVVE 10 / 12
Entertain

Cinema & streaming

We install displays, speakers and streaming sources so every room starts with one simple control—without input hunting or remote clutter.

Intelligent lighting integrated by JYVVE 11 / 12
Compose

Intelligent lighting

We program lights to respond to time, occupancy and routines, with one-touch scenes for everyday moments.

Air quality integrated by JYVVE 12 / 12
Breathe

Air quality

Sensors track particles, CO₂, humidity and VOCs, then trigger filtration, ventilation or alerts when the air needs attention.

Your editable Digital Blueprint

See the complete home.
Shape every decision.

JYVVE turns your ideas into a living, room-by-room proposal. Explore the plan, compare real smart-home product types, adjust priorities and budget, request edits, and approve only when every detail feels right.

01 Explore02 Edit03 Adjust04 Approve
Automatic Blueprint walkthrough
JYVVEDigital Blueprint
Bayfront ResidenceWhole home · Version 04
Client review
Living proposal

Your intelligent home plan

01 / 05
01 · 3D HOME MAP

Every room. Every placement.

Walk through the proposed home and select any room to review its systems.

14 rooms mapped72%
LIVINGKITCHENDININGENTRYPRIMARY
Device placement Intelligent routine Room boundary
Placement confidenceAll installation points verified100%
Coordination noteLighting locations aligned with reflected ceiling planReady
Client actionReview primary-room keypad placement1 note
Exploring the 3D home· guided customer view 01
01 · SEEA three-dimensional plan of the complete home.

Understand rooms, placement, device types, finishes, and intelligent routines before installation begins.

02 · SHAPEAn editable proposal built around your priorities.

Compare alternatives, adjust rooms, phase the work, and see how every choice changes the plan and budget.

03 · APPROVEA clear versioned record of every decision.

Leave notes, request changes, review revisions, sign, and authorize only the Blueprint you are ready to build.

Your home, fully considered

One proposal. Every room. Nothing hidden.

Start my Blueprint
Intelligent routines

Your home follows
the rhythm of your day.

Whole-home intelligence

One natural command—or the context around you—can become a coordinated response across the entire home. JYVVE designs the intelligence, then keeps the experience effortless.

Adaptive orchestrationContext becomes a coordinated whole-home response.
Natural voiceOne command moves every approved system together.
Questions, answered

Clear answers.
Confidence before commitment.

The technology may be complex. Your experience should never feel that way. Here is what homeowners ask before we begin—and how JYVVE keeps every decision clear.

A JYVVE Intelligent Home Integrator ready to guide a homeowner
JYVVE · Intelligent Home Integrator One expert beside you.

Clear guidance from the first walkthrough through handoff.

JYVVE is the accountable Intelligent Home Integrator—from discovery and your Digital Blueprint through product planning, specialist coordination, installation, routines, testing and handoff. One expert keeps the complete experience moving together.

Your Blueprint is an editable, room-by-room proposal showing system priorities, product types, quantities, placement, routines, alternatives and budget direction. You review and adjust it before anything is ordered or installed.

Yes. JYVVE installs and configures the approved intelligent-home products, coordinates licensed or specialist work when required, connects the systems and tests the finished experience before handoff.

Both. We design for finished homes, renovations, additions and new construction. The Blueprint reflects the home's real conditions, available infrastructure and project timing so the plan is practical from the start.

Often, yes. We evaluate compatibility and reliability, keep what strengthens the experience and recommend replacement only when it materially improves performance, simplicity or long-term support.

No. JYVVE selects the right mix for your home and confirms how the pieces work together. Your plan is built around the experience you want—not a dealer platform or one manufacturer's catalog.

One simple trigger can coordinate lighting, climate, shades, audio, security and more. We build routines such as Wake, Reset and Sleep around your household, then refine them until they feel natural.

Privacy is a design decision, not an afterthought. We review access, permissions, recording, retention and local-versus-cloud features with you, then configure the approved approach so your household remains in control.

Your JYVVE professional engagement is shown clearly. Products, subscriptions and licensed or specialist trade work remain separate, visible and approved by you. A tailored range follows the Blueprint and site review.

Yes. The Blueprint can separate now, next and later—protecting the core architecture so future phases build on the original plan instead of forcing you to start over.

Timing depends on the home, scope, product availability and any specialist work. Your Blueprint gives you a realistic sequence before ordering begins, with milestones kept visible as the project moves forward.

We complete a clear handoff, explain how everything works and leave your Blueprint as the home's living roadmap. JYVVE remains available for adjustments, additions and the next phase as your needs evolve.

Your home, considered

Ready for the intelligent home
to finally arrive?

Complete a short brief to see the professional fee, full scope and how JYVVE can bring a new kind of intelligence to your home.

Get pricing